Campylobacter coli OR12: ATE51_03500 Help Entry ATE51_03500       CDS       T04527                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ccoo  Campylobacter coli OR12 Pathway ccoo00790   Folate biosynthesis ccoo01100   Metabolic pathways ccoo01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ccoo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ATE51_03500 Enzymes [BR:ccoo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ATE51_03500  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ATE51_03500  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ATE51_03500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ALV00259 LinkDB All DBs Position 1665557..1665874 Genome browser AA seq 105 aa AA seqDB search MQSHINIKMQFKCIIGILKFERKKKQKVCIYLTAKANDFLDYAKVSKKIKKYYKKEQFLT LEESLEFVCAKLHRKFPQIYYIKIKTYKPEIIKNARVGVKLKKIY NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcaaagtcatataaatatcaaaatgcagtttaaatgcattataggaatattaaaattt gaacgcaagaaaaaacaaaaggtttgtatttatcttacagctaaagcaaatgatttttta gattatgccaaggtatcaaaaaaaatcaaaaaatactataaaaaagaacaatttcttacc ctagaagaatctttagaatttgtttgtgcgaaattacatagaaaatttccgcaaatttac tatattaaaatcaaaacttataaacctgaaataatcaaaaatgcaagagttggtgtaaaa ttaaaaaaaatttattaa

DBGET integrated database retrieval system