Cariama cristata (Red-legged seriema): 104156456 Help Entry 104156456         CDS       T08341                                  Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ccri  Cariama cristata (Red-legged seriema) Pathway ccri00860   Porphyrin metabolism ccri04216   Ferroptosis ccri04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccri00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     104156456  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     104156456    04217 Necroptosis     104156456  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccri04147]     104156456 Enzymes [BR:ccri01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      104156456 Exosome [BR:ccri04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104156456   Exosomal proteins of bladder cancer cells    104156456 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  104156456 NCBI-ProteinID:  XP_009697020 LinkDB All DBs Position Unknown AA seq 145 aa AA seqDB search SYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWENGL TAMECALHLEKNVNQSLLELHKLATEKNDPHLCDFIETHYLDEQVKSIKELGDHVTNLRK MGAPKYGMAEYLFDKHTLGDSDNES NT seq 438 nt NT seq  +upstreamnt  +downstreamnt tcctactattttgaccgggatgatgtggcactcaaaaactttgccaagtacttcctgcat cagtcccacgaggaacgtgagcatgctgagaaactgatgaagctacagaatcagaggggc ggacgtatcttcttgcaggacatcaagaagccagatcgtgatgactgggagaatggactg actgcaatggagtgtgccctgcacctggagaagaatgtgaaccagtcactgttagaactg cacaaattggcaactgaaaagaatgacccacacttgtgtgacttcattgagactcattac ctggatgaacaggtgaaatccatcaaagagctgggtgaccatgtgaccaacctgcggaag atgggggcaccaaaatatggcatggcagagtacctctttgacaagcacaccctcggggac agtgacaatgagagctga

DBGET integrated database retrieval system