Campylobacter curvus: CCV52592_1694 Help Entry CCV52592_1694     CDS       T00576                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ccv  Campylobacter curvus Pathway ccv00790   Folate biosynthesis ccv01100   Metabolic pathways ccv01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ccv00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CCV52592_1694 (folB) Enzymes [BR:ccv01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CCV52592_1694 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CCV52592_1694 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CCV52592_1694 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF4327 Motif Other DBs NCBI-ProteinID:  EAU01058 UniProt:  A7H059 LinkDB All DBs Position 1598828..1599154 Genome browser AA seq 108 aa AA seqDB search MSQKITTLIKDHEFETIIGMLDFERTTPQKVRMNASFCSSGFIDYVSVIEFIEKFYNERK FKSVEESLEATSKALKENFKDLISLNLEILKIEILKNATVGAKIESVY NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgagccaaaaaataacgacgctcatcaaagatcatgagtttgaaacgatcatagggatg cttgactttgagcgcactacgcctcaaaaagtgcgtatgaacgccagtttttgcagtagc ggattcatcgactatgtcagcgtgatagaatttatagaaaaattttacaacgagcgaaaa tttaaaagtgtcgaagagtcgcttgaagccacttcaaaggctttaaaagaaaattttaag gatctgatttccttaaatttagaaattttaaaaatcgaaatcctgaaaaatgcgacggtc ggtgcgaaaatagaatccgtttattaa

DBGET integrated database retrieval system