Cellvibrio sp. PSBB023: B0D95_19960 Help Entry B0D95_19960       CDS       T04725                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ceb  Cellvibrio sp. PSBB023 Pathway ceb00261   Monobactam biosynthesis ceb01100   Metabolic pathways ceb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ceb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B0D95_19960  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ceb01008]     B0D95_19960 Polyketide biosynthesis proteins [BR:ceb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B0D95_19960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQT62131 UniProt:  A0A1U9NET4 LinkDB All DBs Position complement(4615067..4615288) Genome browser AA seq 73 aa AA seqDB search MSDSVFDDDSLTFLVLVNDEYQYSLWPDMLPIPNGWHHTLGPTSRQHCLDWLSTHWTDLR PYSLRQTDGAKAS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagtgacagtgtatttgacgatgattcgcttacatttctggttttagtcaatgatgaa taccagtactcactatggccggacatgctgcccattcccaatggttggcaccacaccttg gggccaacatcgcgccagcattgcctggactggctgtccactcactggacagatttacgc ccctattccctgcggcaaacagatggagccaaggcatcatga

DBGET integrated database retrieval system