Cellvibrio sp. PSBB006: CBR65_03470 Help Entry CBR65_03470       CDS       T04891                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism cell  Cellvibrio sp. PSBB006 Pathway cell00261   Monobactam biosynthesis cell01100   Metabolic pathways cell01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cell00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CBR65_03470  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cell01008]     CBR65_03470 Polyketide biosynthesis proteins [BR:cell01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CBR65_03470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARU26555 UniProt:  A0A1Y0FTY5 LinkDB All DBs Position complement(831023..831253) Genome browser AA seq 76 aa AA seqDB search MSDYNDEDRLYKVVLNHEEQYSLWPLEKANAPGWVDEGTVGNKAKCLAHIENVWTDMRPL SLRKYMEKIDKENSIA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtgattataatgatgaagatcgtttgtataaagtagttcttaatcatgaagaacag tactcgctttggcctttagaaaaagcaaatgctccaggctgggtagatgaaggaacagtt ggaaacaaggcaaagtgcttggctcatatagaaaatgtttggacagacatgaggccgcta agtctaagaaaatatatggagaaaatagataaagaaaatagtattgcttaa

DBGET integrated database retrieval system