Coprobacter fastidiosus: Cfast33896_07190 Help Entry Cfast33896_07190  CDS       T09127                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cfas  Coprobacter fastidiosus Pathway cfas00020   Citrate cycle (TCA cycle) cfas01100   Metabolic pathways cfas01110   Biosynthesis of secondary metabolites cfas01120   Microbial metabolism in diverse environments cfas01200   Carbon metabolism cfas01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cfas00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Cfast33896_07190 Enzymes [BR:cfas01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Cfast33896_07190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_6 Fer4_9 Fer4_4 Fer4_16 Fer4_17 Fer4_13 Fer4_15 Fer4_8 Fer4_22 Fer4_3 Fer4_18 Baculo_VP1054 Chordopox_G2 Motif Other DBs NCBI-ProteinID:  BEG61764 LinkDB All DBs Position 901866..902093 Genome browser AA seq 75 aa AA seqDB search MAKIKGAVVVNNERCKGCELCVVACPADVLALQPKEVNDKGYHYAYMKNPDNCIGCASCG YVCPDGCITVYKVKL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctaagataaaaggtgctgttgtagtgaacaacgagcgttgcaaaggatgcgaactt tgcgttgtggcatgtcctgctgacgtgttggctctccagccgaaagaggtaaacgataaa gggtatcattatgcatacatgaaaaatcccgataattgtatcggatgtgccagttgcggt tatgtttgtcccgacggatgtattaccgtatataaagtaaaactataa

DBGET integrated database retrieval system