Chryseobacterium fluminis: ODZ84_10245 Help Entry ODZ84_10245       CDS       T09749                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cflu  Chryseobacterium fluminis Pathway cflu00790   Folate biosynthesis cflu01100   Metabolic pathways cflu01240   Biosynthesis of cofactors Module cflu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:cflu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ODZ84_10245 (folB) Enzymes [BR:cflu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ODZ84_10245 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ODZ84_10245 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ODZ84_10245 (folB) BRITE hierarchy Motif Pfam:  FolB IBD Condensin2nSMC Motif Other DBs NCBI-ProteinID:  UZT99910 LinkDB All DBs Position 2247940..2248308 Genome browser AA seq 122 aa AA seqDB search MSTIYLEDLKIYAYHGVLPEENLIGTYYILNVEVHTDLWKASESDDLNDTISYADINEII HSEMKIKSKLLEHVAGRIISKIHENFSQIDYIKLKITKTAPPMKGEMKGASIELEKSFKP QN NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagtacaatttatcttgaagatcttaaaatatatgcctaccatggggtgctgcctgaa gagaacctgatcggaacgtattatattcttaatgtcgaggttcacaccgatctctggaaa gcatccgaatcagatgatctcaatgataccataagctatgccgacatcaatgaaattatt catagcgaaatgaaaattaagtctaaactgctggaacatgtagccggaaggattatatca aaaatccacgaaaatttttctcagatcgactatatcaaacttaaaatcaccaaaacggct cccccaatgaaaggggaaatgaaaggagccagtattgaactggaaaaaagctttaaacca caaaattaa

DBGET integrated database retrieval system