Camelus ferus (Wild Bactrian camel): 102523238 Help Entry 102523238         CDS       T02979                                  Name (RefSeq) ferritin light chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr00860   Porphyrin metabolism cfr04216   Ferroptosis cfr04217   Necroptosis cfr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:cfr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     102523238  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     102523238    04217 Necroptosis     102523238  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     102523238  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102523238 Enzymes [BR:cfr01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      102523238 Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102523238   Exosomal proteins of bladder cancer cells    102523238 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  102523238 NCBI-ProteinID:  XP_032315386 UniProt:  S9X8L7 LinkDB All DBs Position 2:complement(59179004..59181229) Genome browser AA seq 162 aa AA seqDB search MHLWASYSYLSLGFYFDCEDVALEGVGHFFHELAEEKQEGDDWLLKLQNQHSGCTLFQDV QKPPHDEWDKTQDATEATVLREKNLNQALLDLCALGSACADPHLCDFWESHFLDEEVTLI KKIGDLLTNLCRLSGPQAGLGDYLLERLTLKHDYEPLQPSSL NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgcatctgtgggcttcctacagctacctctctctgggcttctatttcgactgcgaggat gtggctctggagggtgtgggccactttttccacgaattggctgaggagaagcaagaaggc gatgactggctcttgaaattgcaaaaccagcacagcggctgcaccctcttccaggacgtg cagaagccacctcatgacgagtgggataagacccaggacgctacggaagcaactgtgctc cgagagaagaacctgaaccaggcccttttggatctgtgtgccctgggttctgcctgtgca gacccccacctctgtgacttctgggagagccatttcctagatgaggaggtgacactcatc aagaagataggcgacctcctgactaacctctgcaggctgtctggtccccaggctgggctg ggtgactacctcttggaaaggctcaccctcaagcacgactatgagcctctgcaacccagc agcctttga

DBGET integrated database retrieval system