Collimonas fungivorans: CFU_2303 Help Entry CFU_2303          CDS       T01583                                  Name (GenBank) Hypothetical MbtH-like protein   KO K05375   MbtH protein Organism cfu  Collimonas fungivorans Pathway cfu00261   Monobactam biosynthesis cfu01100   Metabolic pathways cfu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CFU_2303  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cfu01008]     CFU_2303 Polyketide biosynthesis proteins [BR:cfu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CFU_2303 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEK62130 UniProt:  G0A924 LinkDB All DBs Position complement(2749643..2749921) Genome browser AA seq 92 aa AA seqDB search MHFEPGLTMTQTQNSAAAEADDVIYTVVINDEEQYSIWPTFRAVPAGWREVGVSGPKAAC LAHIESAWTDMRPASLRRHMDDAAAQARGTLS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcatttcgaaccaggactgaccatgacacaaacacagaattccgccgccgcagaggca gatgacgttatctacacagtcgtcatcaacgacgaagagcagtactcgatctggccgact ttccgcgccgtgccggccggctggcgcgaggtcggcgtgagcggcccgaaagccgcatgc cttgcgcatatcgagtcagcctggaccgacatgcgcccggccagcctgcgccgccatatg gatgacgctgcagcgcaggcgcgcgggaccttatcataa

DBGET integrated database retrieval system