Corynebacterium freneyi: I6L56_10230 Help Entry I6L56_10230       CDS       T08562                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism cfy  Corynebacterium freneyi Pathway cfy00261   Monobactam biosynthesis cfy01100   Metabolic pathways cfy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     I6L56_10230  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cfy01008]     I6L56_10230 Polyketide biosynthesis proteins [BR:cfy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     I6L56_10230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DR2241 Motif Other DBs NCBI-ProteinID:  QXA52424 LinkDB All DBs Position 2339243..2339455 Genome browser AA seq 70 aa AA seqDB search MNPFDDPEGRFIVVVNDRGEYSLWPTFAEVPDGWRARSGELSRAEALTFVERAWTDPPGS GRRPEGGDDD NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgaatcctttcgatgatcccgagggccgcttcatcgtggtcgtcaacgaccggggcgaa tactcgctctggccgacgttcgccgaggttcccgacgggtggcgggcgcgcagcggtgag ctgagccgagctgaggcgctgactttcgtcgagcgcgcgtggaccgacccgccgggctcc ggccggcgccccgaaggcggggacgatgactga

DBGET integrated database retrieval system