Cyanobium gracile: Cyagr_0135 Help Entry Cyagr_0135        CDS       T02359                                  Name (GenBank) FolB domain protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cgc  Cyanobium gracile Pathway cgc00790   Folate biosynthesis cgc01100   Metabolic pathways cgc01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:cgc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Cyagr_0135 Enzymes [BR:cgc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Cyagr_0135  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Cyagr_0135  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Cyagr_0135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AFY27348 UniProt:  K9P325 LinkDB All DBs Position 132585..132947 Genome browser AA seq 120 aa AA seqDB search MTEAIHVRGLRVWAHVGVYEHERRHGQWFELAFSLGVDLGAVARSDDLSQGFDYGRGIAA LQEQARTVRCLTLEHYSERILDLLEDCYGPIPLALELSKCQVPVPGFDGSVAVSRKRRWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt gtgaccgaggcgatccatgtgcggggcctgcgggtgtgggcccatgtcggggtgtacgag cacgaacggcgccacggccagtggttcgagctggccttctccctgggggtcgatctgggc gccgtggcccgcagcgacgacctgagccagggcttcgactacggccgcggcatcgcggcg ctgcaggagcaggcccgcaccgtccgctgcctcaccctggagcactacagcgagcggatc ctcgatctgctggaggactgttacgggccgatcccgctggctctggagctgagcaagtgc caggtgccggttcccggcttcgacggcagcgtggcggtgagccgcaagcggcgctggggg tga

DBGET integrated database retrieval system