Chromobacterium haemolyticum: CH06BL_06030 Help Entry CH06BL_06030      CDS       T06734                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism chae  Chromobacterium haemolyticum Pathway chae00261   Monobactam biosynthesis chae01100   Metabolic pathways chae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chae00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CH06BL_06030  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:chae01008]     CH06BL_06030 Polyketide biosynthesis proteins [BR:chae01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CH06BL_06030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBH11355 LinkDB All DBs Position 691722..691955 Genome browser AA seq 77 aa AA seqDB search MTQDAMNETKYIVVMNHEEQYSIWPEYRDIPAGWRSLGVSGAEQECLDYIEKNWTDMRPL SLRQFMQENQTASPSAN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgacgcaggacgcgatgaacgaaaccaaatacatcgtggtgatgaatcatgaagagcaa tattcgatatggccggaatatcgcgacattccagccggctggcgctcgcttggcgtcagc ggcgcggaacaggaatgcctggactatattgaaaagaactggacggatatgcgtccgttg agcctgagacaattcatgcaggaaaatcaaacggcttccccttccgctaattaa

DBGET integrated database retrieval system