Chelatococcus sp. CO-6: AL346_04820 Help Entry AL346_04820       CDS       T04040                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism chel  Chelatococcus sp. CO-6 Pathway chel00261   Monobactam biosynthesis chel01100   Metabolic pathways chel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chel00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AL346_04820  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:chel01008]     AL346_04820 Polyketide biosynthesis proteins [BR:chel01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AL346_04820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALA16855 LinkDB All DBs Position complement(1001138..1001347) Genome browser AA seq 69 aa AA seqDB search MANPFDDEDGVFLVLVNDEGQHSLWPSFADVPAGWQTVHGPAARQECLDYVSAHWTDMRP RSLIAAEET NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggccaatcccttcgacgatgaggacggcgtcttcctggtgctcgtcaacgacgagggc cagcattcgctctggccgtccttcgcggacgtgcccgcgggctggcagacggtgcacggg ccggccgcccgccaggaatgcctcgattatgtgtcggcccactggaccgacatgcgcccg cgcagcttgatcgcggccgaagagacgtga

DBGET integrated database retrieval system