Chromobacterium phragmitis IIBBL 112-1: DK842_18520 Help Entry DK842_18520       CDS       T05549                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism chri  Chromobacterium phragmitis IIBBL 112-1 Pathway chri00261   Monobactam biosynthesis chri01100   Metabolic pathways chri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chri00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DK842_18520  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:chri01008]     DK842_18520 Polyketide biosynthesis proteins [BR:chri01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DK842_18520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXE31720 UniProt:  A0A344UCP9 LinkDB All DBs Position 3893960..3894172 Genome browser AA seq 70 aa AA seqDB search MSAEQTNPFDDESLSFLVLVNRQDQHSLWPATLPPPAGWNVARGPDSRAACVAYLDANWT DIRPRSLRSG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcgcggagcaaaccaatcctttcgatgacgaaagcctttcctttctcgtcctggta aaccgccaggaccaacacagcctgtggccggcgacgctgccgccgccagccggctggaac gtggcgcggggacctgacagccgcgccgcgtgcgttgcttatctcgacgccaactggacc gacatccgcccgcgatcgctgcgcagcggttaa

DBGET integrated database retrieval system