Chromobacterium sp. ATCC 53434: CXB49_07670 Help Entry CXB49_07670       CDS       T05234                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism chro  Chromobacterium sp. ATCC 53434 Pathway chro00261   Monobactam biosynthesis chro01100   Metabolic pathways chro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CXB49_07670  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:chro01008]     CXB49_07670 Polyketide biosynthesis proteins [BR:chro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CXB49_07670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AUH50688 UniProt:  A0A2H5DUF4 LinkDB All DBs Position complement(1647522..1647746) Genome browser AA seq 74 aa AA seqDB search MANPFDNKEGVFFSLINDEGQYSLWPEFAPIPDGWQTSFGPADRQTCLDHIEQNWMDMRP ASLVRAQDELLSTG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcgaatccgttcgacaacaaggaaggcgtttttttctccctgatcaacgatgagggc cagtactcgctctggcccgaattcgcgccgattccggacggttggcaaacgagtttcggc cccgccgaccgccagacctgtctcgaccacatcgagcaaaactggatggacatgcgcccc gccagcctggtccgcgctcaggacgagctgctctccacaggctga

DBGET integrated database retrieval system