Chromobacterium sp. ATCC 53434: CXB49_07995 Help Entry CXB49_07995       CDS       T05234                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism chro  Chromobacterium sp. ATCC 53434 Pathway chro00261   Monobactam biosynthesis chro01100   Metabolic pathways chro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CXB49_07995  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:chro01008]     CXB49_07995 Polyketide biosynthesis proteins [BR:chro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CXB49_07995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AUH50746 UniProt:  A0A2H5DUL5 LinkDB All DBs Position 1729032..1729265 Genome browser AA seq 77 aa AA seqDB search MAQDAISEAKYLVVVNHEEQYSIWPDYREIPVGWRSAGVSGSEKECLDHIEKTWTDMRPL SLRKFMQENQTASPLTE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcgcaggatgcgatcagcgaagcgaaatacctcgttgtggtgaatcacgaggaacaa tactcgatatggccggattatcgcgagattcccgttggttggcgctctgcaggcgtcagt ggcagcgaaaaggaatgcctggaccatattgaaaaaacctggacggacatgcggccgctt agcctgagaaaattcatgcaggaaaatcaaactgcgtcccctttgactgaatga

DBGET integrated database retrieval system