Capra hircus (goat): 100860816 Help Entry 100860816         CDS       T02910                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism chx  Capra hircus (goat) Pathway chx01523   Antifolate resistance chx04010   MAPK signaling pathway chx04060   Cytokine-cytokine receptor interaction chx04064   NF-kappa B signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04625   C-type lectin receptor signaling pathway chx04640   Hematopoietic cell lineage chx04657   IL-17 signaling pathway chx04659   Th17 cell differentiation chx04668   TNF signaling pathway chx04750   Inflammatory mediator regulation of TRP channels chx04932   Non-alcoholic fatty liver disease chx04933   AGE-RAGE signaling pathway in diabetic complications chx04936   Alcoholic liver disease chx04940   Type I diabetes mellitus chx05010   Alzheimer disease chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05132   Salmonella infection chx05133   Pertussis chx05134   Legionellosis chx05135   Yersinia infection chx05140   Leishmaniasis chx05142   Chagas disease chx05143   African trypanosomiasis chx05144   Malaria chx05146   Amoebiasis chx05152   Tuberculosis chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05168   Herpes simplex virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05321   Inflammatory bowel disease chx05323   Rheumatoid arthritis chx05332   Graft-versus-host disease chx05417   Lipid and atherosclerosis chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100860816 (IL1B)    04064 NF-kappa B signaling pathway     100860816 (IL1B)    04668 TNF signaling pathway     100860816 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100860816 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100860816 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100860816 (IL1B)    04620 Toll-like receptor signaling pathway     100860816 (IL1B)    04621 NOD-like receptor signaling pathway     100860816 (IL1B)    04623 Cytosolic DNA-sensing pathway     100860816 (IL1B)    04625 C-type lectin receptor signaling pathway     100860816 (IL1B)    04659 Th17 cell differentiation     100860816 (IL1B)    04657 IL-17 signaling pathway     100860816 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100860816 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     100860816 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100860816 (IL1B)    05164 Influenza A     100860816 (IL1B)    05162 Measles     100860816 (IL1B)    05168 Herpes simplex virus 1 infection     100860816 (IL1B)    05163 Human cytomegalovirus infection     100860816 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     100860816 (IL1B)    05135 Yersinia infection     100860816 (IL1B)    05133 Pertussis     100860816 (IL1B)    05134 Legionellosis     100860816 (IL1B)    05152 Tuberculosis     100860816 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100860816 (IL1B)    05144 Malaria     100860816 (IL1B)    05140 Leishmaniasis     100860816 (IL1B)    05142 Chagas disease     100860816 (IL1B)    05143 African trypanosomiasis     100860816 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     100860816 (IL1B)    05321 Inflammatory bowel disease     100860816 (IL1B)    05332 Graft-versus-host disease     100860816 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     100860816 (IL1B)    05020 Prion disease     100860816 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     100860816 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100860816 (IL1B)    05418 Fluid shear stress and atherosclerosis     100860816 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100860816 (IL1B)    04936 Alcoholic liver disease     100860816 (IL1B)    04932 Non-alcoholic fatty liver disease     100860816 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     100860816 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100860816 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     100860816 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:chx00536]     100860816 (IL1B) Cytokines and neuropeptides [BR:chx04052]  Cytokines   Interleukins    100860816 (IL1B) Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Cytokines    100860816 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  100860816 NCBI-ProteinID:  XP_013823154 EnsemblRapid:  ENSCHIG00000024469 UniProt:  A7Y3X8 LinkDB All DBs Position 11:complement(46178464..46186246) Genome browser AA seq 266 aa AA seqDB search MATVPEPINEVMAYYSDENELLFEADGPKQMKSCTQHLDLGSMGDGNIQLQISHQLYNKS FRQVVSVIVAMEKLRSRAYEHVFRDDDLRSILSFIFEEEPVIFETSSDELLCDAAVQSVK CKLQDREQKSLVLDSPCVLKALHLLSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNL YLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQI EEKPVFLGHFRGGQDITDFRMETLSP NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcaaccgtacctgaacccattaatgaagtgatggcttactacagtgatgagaatgag ctgttatttgaggctgatggccccaaacagatgaagagctgcacccaacacctggacctc ggctccatgggagatggaaacatccagctgcagatttctcaccagctctacaacaaaagc ttcaggcaggtggtgtcggtcatcgtggccatggagaagctgaggagccgtgcctacgaa catgtcttccgtgatgatgacctgaggagcatcctttcattcatctttgaagaagagcct gtcatcttcgaaacatcctccgatgagcttctgtgtgacgcagccgtgcagtcagtaaaa tgcaaactccaggacagagagcaaaaatccctggtgctggatagcccatgtgtgctgaag gctctccacctcctctcacaggaaatgagccgagaagtggtgttctgcatgagcttcgta caaggagaggaaagagacaacaagattcctgtggccttgggtatcagggacaagaatcta tacctgtcttgtgtgaaaaaaggtgatacgccgacactgcagctggaggaagtagacccc aaagtctaccccaagaggaatatggaaaagcgattcgtcttctacaagacagaaatcaag aacacagttgaatttgagtctgtcctgtaccctaactggtacatcagcacttctcaaatc gaagaaaagcccgtcttcctgggacattttagaggtggccaggatataactgacttcaga atggaaaccctctctccctaa

DBGET integrated database retrieval system