Capra hircus (goat): 1485864 Help Entry 1485864           CDS       T02910                                  Symbol ND4L, KEF96_p05 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism chx  Capra hircus (goat) Pathway chx00190   Oxidative phosphorylation chx01100   Metabolic pathways chx04714   Thermogenesis chx04723   Retrograde endocannabinoid signaling chx05010   Alzheimer disease chx05012   Parkinson disease chx05014   Amyotrophic lateral sclerosis chx05016   Huntington disease chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05208   Chemical carcinogenesis - reactive oxygen species chx05415   Diabetic cardiomyopathy Module chx_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:chx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     1485864 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     1485864 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     1485864 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     1485864 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     1485864 (ND4L)    05012 Parkinson disease     1485864 (ND4L)    05014 Amyotrophic lateral sclerosis     1485864 (ND4L)    05016 Huntington disease     1485864 (ND4L)    05020 Prion disease     1485864 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     1485864 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     1485864 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:chx03029]     1485864 (ND4L) Enzymes [BR:chx01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      1485864 (ND4L) Mitochondrial biogenesis [BR:chx03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     1485864 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  1485864 NCBI-ProteinID:  YP_004111304 UniProt:  Q7YBC1 S6ASB2 LinkDB All DBs Position MT:9878..10174 Genome browser AA seq 98 aa AA seqDB search MSLVYMNIMTAFAVSLTGLLMYRSHLMSSLLCLEGMMLSLFIMATLMILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtccctcgtatacataaatattataacagcattcgcagtatctctcacaggactattg atatatcgatctcacctaatatcctccctcctatgcctagaaggaataatattatctcta tttatcatagccaccctaatgatcctaaattcacacttcaccttagccagcataatacct attatcttactagttttcgcagcctgcgaagcagcactaggcctgtccttactagtaatg gtatcaaacacatatggtaccgattacgtacaaaaccttaacttattacaatgctaa

DBGET integrated database retrieval system