Celeribacter indicus: P73_3983 Help Entry P73_3983          CDS       T03575                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism cid  Celeribacter indicus Pathway cid00261   Monobactam biosynthesis cid01100   Metabolic pathways cid01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cid00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     P73_3983  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cid01008]     P73_3983 Polyketide biosynthesis proteins [BR:cid01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     P73_3983 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJE48698 UniProt:  A0A0B5DZ60 LinkDB All DBs Position 4089111..4089374 Genome browser AA seq 87 aa AA seqDB search MSPSPISPSPLARAPWRILRSGDGRYSVHPAAHDIPAGWEAVGEPAPREACLTRIAALWT DMRPAALRDAMNEPAAPCDAMDEETTA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtccccttcccccatctccccttcccccttggcccgtgcgccctggcgcatcttgcgc agcggcgatggccggtattccgtccatcccgcggctcatgacatcccggcaggctgggag gcggtcggagagccggctccgcgcgaggcgtgcctgacacggatcgccgcgctctggacc gacatgcgccccgcggcgctgcgcgacgcgatgaacgaacccgcggcgccttgcgacgca atggacgaggagacgacggcatga

DBGET integrated database retrieval system