Celeribacter indicus: P73_4419 Help Entry P73_4419          CDS       T03575                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism cid  Celeribacter indicus Pathway cid00260   Glycine, serine and threonine metabolism cid01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:cid00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     P73_4419 Enzymes [BR:cid01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      P73_4419     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      P73_4419 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD zf-ribbon_3 Motif Other DBs NCBI-ProteinID:  AJE49134 UniProt:  A0A0B5E1K3 LinkDB All DBs Position pP73A:37420..37722 Genome browser AA seq 100 aa AA seqDB search MLLIHCPYCGETLPEAEFAYAGEAHVARPEAPASQTDEEWESYLFIRTNVRGPHYERWRH VHGCGRFFNAVRDTVSDRFHTTYKAGDPRPDLSALLEEQK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcttttgatccattgcccctattgcggggaaaccctgccggaagccgaattcgcctat gccggcgaggcgcatgtggcgcgtcccgaggcgccggcgtcgcagaccgatgaggaatgg gaaagctacctgttcatccgcaccaacgtgagggggccgcattacgaacgctggcgccat gtccacggctgcgggcggttcttcaacgcggtgcgcgacacggtgagcgatcgcttccac accacctacaaggcgggcgatccgcgtcccgacctctcggcactcctggaggagcagaaa tga

DBGET integrated database retrieval system