Coccidioides immitis: CIMG_00666 Help Entry CIMG_00666        CDS       T01114                                  Name (RefSeq) DNA-directed RNA polymerase I   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism cim  Coccidioides immitis Pathway cim03020   RNA polymerase cim03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cim00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CIMG_00666   09124 Replication and repair    03420 Nucleotide excision repair     CIMG_00666  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cim03021]     CIMG_00666    03400 DNA repair and recombination proteins [BR:cim03400]     CIMG_00666 Transcription machinery [BR:cim03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CIMG_00666   RNA polymerase III system    RNA polymerase III      CIMG_00666   RNA polymerase I system    RNA polymerase I      CIMG_00666 DNA repair and recombination proteins [BR:cim03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CIMG_00666 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 Motif Other DBs NCBI-GeneID:  4565643 NCBI-ProteinID:  XP_001246895 UniProt:  J3KHH2 LinkDB All DBs AA seq 146 aa AA seqDB search MSDPILFEDTFTITSINAQKYDRVSRISCTSTDQLTTFTLDVNSELYRCAPGESLSLALA STLALDGKDEGAGGRAVWRDVGMGETTLANDYDYVCYGKVYRFEDSSTAGNMAVFVSFGG LLLYLDGPYKKLNPLRIDYVYLLIKK NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgtctgacccgatcctcttcgaagacaccttcactatcacgtcaattaacgctcaaaaa tacgatcgcgtctctcgtatcagctgtacgtccacagatcagctaaccaccttcactctt gacgtaaactctgagctctatcgttgcgcgcctggtgaatctctttcactcgctctcgca tccacattagcgctagacggtaaagatgaaggtgccggagggcgagctgtttggagagac gtaggtatgggcgagacaacattggcaaatgactatgactacgtgtgctatgggaaagtc tatcgatttgaagacagtagcacggcggggaacatggctgtctttgtttcatttggcgga ttacttctgtatctggatggaccatacaagaagctcaacccgttgagaatcgactacgtt tacctcttgataaagaaataa

DBGET integrated database retrieval system