Chitinimonas koreensis: H9L41_13060 Help Entry H9L41_13060       CDS       T08620                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism cks  Chitinimonas koreensis Pathway cks00261   Monobactam biosynthesis cks01100   Metabolic pathways cks01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cks00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H9L41_13060  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cks01008]     H9L41_13060 Polyketide biosynthesis proteins [BR:cks01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H9L41_13060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNM94857 LinkDB All DBs Position complement(3125383..3125595) Genome browser AA seq 70 aa AA seqDB search MSTEQLNPFDDESQPFLVLANAQQQHSLWPTFAAVPAGWRVVLGPDSRAACVDWLERNWT DIRPLAVRGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgaacagctgaaccccttcgacgacgagagccaacccttcctggtgctggcc aatgcccagcagcagcacagcctgtggccgaccttcgccgcggtgccggccggctggcgg gtggtgctggggccggacagccgcgccgcctgcgtcgactggctcgaacgcaactggacc gatatccggccgctggccgtgcgcggcgcctga

DBGET integrated database retrieval system