Nitratidesulfovibrio liaohensis: KPS_000724 Help Entry KPS_000724        CDS       T09362                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism clih  Nitratidesulfovibrio liaohensis Pathway clih00020   Citrate cycle (TCA cycle) clih01100   Metabolic pathways clih01110   Biosynthesis of secondary metabolites clih01120   Microbial metabolism in diverse environments clih01200   Carbon metabolism clih01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:clih00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     KPS_000724 Enzymes [BR:clih01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      KPS_000724 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_9 Fer4_21 Fer4_2 Fer4_10 Fer4_4 Fer4_6 Fer4_16 Fer4_8 Fer4_17 Fer4_3 DUF3645 Fer4_15 Motif Other DBs NCBI-ProteinID:  WMW66168 UniProt:  A0AA51YQP4 LinkDB All DBs Position 799106..799432 Genome browser AA seq 108 aa AA seqDB search MSKKQKGQTRVCVYPDWCKGCGLCVAFCPAKVLVLNAFGKAEVAHEDECINCGFCELHCP DFAIAIKPRTRNGASQPDPRSEWSDPENEHGRASPPVRTAEPNPNPEE NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgtcaaagaagcaaaaaggtcagacccgcgtctgtgtgtaccccgactggtgcaagggc tgcggcctgtgcgttgccttctgccccgccaaggtgcttgtgctgaacgccttcggcaag gccgaggtggcccacgaggacgaatgcatcaattgcgggttctgcgagctgcactgtccg gacttcgccattgccatcaagccgcgcacccgcaacggtgcaagccagccggacccccgc agcgaatggagcgaccccgagaacgaacatggtcgcgcctcgcccccggtgcgcacggcc gaaccgaaccccaaccccgaagagtga

DBGET integrated database retrieval system