KEGG   Canis lupus dingo (dingo): 112665533
Entry
112665533         CDS       T08371                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
clud  Canis lupus dingo (dingo)
Pathway
clud01521  EGFR tyrosine kinase inhibitor resistance
clud01522  Endocrine resistance
clud04010  MAPK signaling pathway
clud04012  ErbB signaling pathway
clud04014  Ras signaling pathway
clud04015  Rap1 signaling pathway
clud04062  Chemokine signaling pathway
clud04068  FoxO signaling pathway
clud04071  Sphingolipid signaling pathway
clud04072  Phospholipase D signaling pathway
clud04137  Mitophagy - animal
clud04140  Autophagy - animal
clud04150  mTOR signaling pathway
clud04151  PI3K-Akt signaling pathway
clud04210  Apoptosis
clud04211  Longevity regulating pathway
clud04213  Longevity regulating pathway - multiple species
clud04218  Cellular senescence
clud04360  Axon guidance
clud04370  VEGF signaling pathway
clud04371  Apelin signaling pathway
clud04540  Gap junction
clud04550  Signaling pathways regulating pluripotency of stem cells
clud04625  C-type lectin receptor signaling pathway
clud04650  Natural killer cell mediated cytotoxicity
clud04660  T cell receptor signaling pathway
clud04662  B cell receptor signaling pathway
clud04664  Fc epsilon RI signaling pathway
clud04714  Thermogenesis
clud04720  Long-term potentiation
clud04722  Neurotrophin signaling pathway
clud04725  Cholinergic synapse
clud04726  Serotonergic synapse
clud04730  Long-term depression
clud04810  Regulation of actin cytoskeleton
clud04910  Insulin signaling pathway
clud04912  GnRH signaling pathway
clud04914  Progesterone-mediated oocyte maturation
clud04915  Estrogen signaling pathway
clud04916  Melanogenesis
clud04917  Prolactin signaling pathway
clud04919  Thyroid hormone signaling pathway
clud04921  Oxytocin signaling pathway
clud04926  Relaxin signaling pathway
clud04929  GnRH secretion
clud04933  AGE-RAGE signaling pathway in diabetic complications
clud04935  Growth hormone synthesis, secretion and action
clud04960  Aldosterone-regulated sodium reabsorption
clud05010  Alzheimer disease
clud05022  Pathways of neurodegeneration - multiple diseases
clud05034  Alcoholism
clud05160  Hepatitis C
clud05161  Hepatitis B
clud05163  Human cytomegalovirus infection
clud05165  Human papillomavirus infection
clud05166  Human T-cell leukemia virus 1 infection
clud05167  Kaposi sarcoma-associated herpesvirus infection
clud05170  Human immunodeficiency virus 1 infection
clud05200  Pathways in cancer
clud05203  Viral carcinogenesis
clud05205  Proteoglycans in cancer
clud05206  MicroRNAs in cancer
clud05207  Chemical carcinogenesis - receptor activation
clud05208  Chemical carcinogenesis - reactive oxygen species
clud05210  Colorectal cancer
clud05211  Renal cell carcinoma
clud05212  Pancreatic cancer
clud05213  Endometrial cancer
clud05214  Glioma
clud05215  Prostate cancer
clud05216  Thyroid cancer
clud05218  Melanoma
clud05219  Bladder cancer
clud05220  Chronic myeloid leukemia
clud05221  Acute myeloid leukemia
clud05223  Non-small cell lung cancer
clud05224  Breast cancer
clud05225  Hepatocellular carcinoma
clud05226  Gastric cancer
clud05230  Central carbon metabolism in cancer
clud05231  Choline metabolism in cancer
clud05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
clud05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:clud00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112665533 (KRAS)
   04012 ErbB signaling pathway
    112665533 (KRAS)
   04014 Ras signaling pathway
    112665533 (KRAS)
   04015 Rap1 signaling pathway
    112665533 (KRAS)
   04370 VEGF signaling pathway
    112665533 (KRAS)
   04371 Apelin signaling pathway
    112665533 (KRAS)
   04068 FoxO signaling pathway
    112665533 (KRAS)
   04072 Phospholipase D signaling pathway
    112665533 (KRAS)
   04071 Sphingolipid signaling pathway
    112665533 (KRAS)
   04151 PI3K-Akt signaling pathway
    112665533 (KRAS)
   04150 mTOR signaling pathway
    112665533 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112665533 (KRAS)
   04137 Mitophagy - animal
    112665533 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    112665533 (KRAS)
   04218 Cellular senescence
    112665533 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112665533 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    112665533 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112665533 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112665533 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    112665533 (KRAS)
   04660 T cell receptor signaling pathway
    112665533 (KRAS)
   04662 B cell receptor signaling pathway
    112665533 (KRAS)
   04664 Fc epsilon RI signaling pathway
    112665533 (KRAS)
   04062 Chemokine signaling pathway
    112665533 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112665533 (KRAS)
   04929 GnRH secretion
    112665533 (KRAS)
   04912 GnRH signaling pathway
    112665533 (KRAS)
   04915 Estrogen signaling pathway
    112665533 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    112665533 (KRAS)
   04917 Prolactin signaling pathway
    112665533 (KRAS)
   04921 Oxytocin signaling pathway
    112665533 (KRAS)
   04926 Relaxin signaling pathway
    112665533 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    112665533 (KRAS)
   04919 Thyroid hormone signaling pathway
    112665533 (KRAS)
   04916 Melanogenesis
    112665533 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112665533 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    112665533 (KRAS)
   04726 Serotonergic synapse
    112665533 (KRAS)
   04720 Long-term potentiation
    112665533 (KRAS)
   04730 Long-term depression
    112665533 (KRAS)
   04722 Neurotrophin signaling pathway
    112665533 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    112665533 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    112665533 (KRAS)
   04213 Longevity regulating pathway - multiple species
    112665533 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    112665533 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112665533 (KRAS)
   05206 MicroRNAs in cancer
    112665533 (KRAS)
   05205 Proteoglycans in cancer
    112665533 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    112665533 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    112665533 (KRAS)
   05203 Viral carcinogenesis
    112665533 (KRAS)
   05230 Central carbon metabolism in cancer
    112665533 (KRAS)
   05231 Choline metabolism in cancer
    112665533 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112665533 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112665533 (KRAS)
   05212 Pancreatic cancer
    112665533 (KRAS)
   05225 Hepatocellular carcinoma
    112665533 (KRAS)
   05226 Gastric cancer
    112665533 (KRAS)
   05214 Glioma
    112665533 (KRAS)
   05216 Thyroid cancer
    112665533 (KRAS)
   05221 Acute myeloid leukemia
    112665533 (KRAS)
   05220 Chronic myeloid leukemia
    112665533 (KRAS)
   05218 Melanoma
    112665533 (KRAS)
   05211 Renal cell carcinoma
    112665533 (KRAS)
   05219 Bladder cancer
    112665533 (KRAS)
   05215 Prostate cancer
    112665533 (KRAS)
   05213 Endometrial cancer
    112665533 (KRAS)
   05224 Breast cancer
    112665533 (KRAS)
   05223 Non-small cell lung cancer
    112665533 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112665533 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    112665533 (KRAS)
   05161 Hepatitis B
    112665533 (KRAS)
   05160 Hepatitis C
    112665533 (KRAS)
   05163 Human cytomegalovirus infection
    112665533 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112665533 (KRAS)
   05165 Human papillomavirus infection
    112665533 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112665533 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    112665533 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    112665533 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    112665533 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112665533 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112665533 (KRAS)
   01522 Endocrine resistance
    112665533 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clud04131]
    112665533 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:clud04031]
    112665533 (KRAS)
Membrane trafficking [BR:clud04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112665533 (KRAS)
GTP-binding proteins [BR:clud04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112665533 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N ThiF Septin AAA_25
Other DBs
NCBI-GeneID: 112665533
NCBI-ProteinID: XP_048958751
Ensembl: ENSCAFG00020012793
LinkDB
Position
27:22355615..22394711
AA seq 236 aa
MGCDIAVATKEEVEVEMVVEEQVANTLQRKARDFVKRKKLIPEGLLKMTEYKLVVVGAGG
VGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMR
TGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDL
ARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKINKEEKTPGCVKIKKCIVM
NT seq 711 nt   +upstreamnt  +downstreamnt
atgggctgtgacattgctgtggccacaaaggaggaggtggaggtagagatggtggtggaa
gaacaggtggccaacaccctgcaacgtaaagcccgtgacttcgtgaaaaggaaaaagtta
atcccagaaggcctgctgaaaatgactgaatataaacttgtggtagttggagctggtggc
gtaggcaagagtgccttgacgatacagctaattcagaatcactttgtggatgaatatgat
cctacaatagaggattcctacaggaaacaagtagtaattgatggagaaacctgtctcttg
gatattctcgacacagcaggtcaagaggagtacagtgcaatgagggaccagtacatgagg
actggggagggctttctttgtgtatttgccataaataatactaaatcatttgaagatatt
caccattatagagaacaaattaaaagagttaaagactctgaagatgtacctatggtccta
gtaggaaataaatgtgatttgccttctagaacagtagacacaaaacaggctcaggactta
gcaagaagttatggaattccttttattgaaacatcagcaaagacaagacagagagtggag
gatgctttttatacattggtgagagagatccgacaatacagattgaaaaaaatcaacaaa
gaagaaaagactcctggctgtgtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system