Cyclopterus lumpus (lumpfish): 117735017 Help Entry 117735017         CDS       T09199                                  Symbol zgc:55558 Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum04010   MAPK signaling pathway clum04012   ErbB signaling pathway clum04068   FoxO signaling pathway clum04137   Mitophagy - animal clum04140   Autophagy - animal clum04150   mTOR signaling pathway clum04210   Apoptosis clum04218   Cellular senescence clum04370   VEGF signaling pathway clum04371   Apelin signaling pathway clum04540   Gap junction clum04625   C-type lectin receptor signaling pathway clum04810   Regulation of actin cytoskeleton clum04910   Insulin signaling pathway clum04912   GnRH signaling pathway clum04914   Progesterone-mediated oocyte maturation clum04916   Melanogenesis Brite KEGG Orthology (KO) [BR:clum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117735017 (zgc:55558)    04012 ErbB signaling pathway     117735017 (zgc:55558)    04370 VEGF signaling pathway     117735017 (zgc:55558)    04371 Apelin signaling pathway     117735017 (zgc:55558)    04068 FoxO signaling pathway     117735017 (zgc:55558)    04150 mTOR signaling pathway     117735017 (zgc:55558)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117735017 (zgc:55558)    04137 Mitophagy - animal     117735017 (zgc:55558)   09143 Cell growth and death    04210 Apoptosis     117735017 (zgc:55558)    04218 Cellular senescence     117735017 (zgc:55558)   09144 Cellular community - eukaryotes    04540 Gap junction     117735017 (zgc:55558)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117735017 (zgc:55558)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117735017 (zgc:55558)   09152 Endocrine system    04910 Insulin signaling pathway     117735017 (zgc:55558)    04912 GnRH signaling pathway     117735017 (zgc:55558)    04914 Progesterone-mediated oocyte maturation     117735017 (zgc:55558)    04916 Melanogenesis     117735017 (zgc:55558)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clum04131]     117735017 (zgc:55558)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:clum04031]     117735017 (zgc:55558) Membrane trafficking [BR:clum04131]  Endocytosis   Macropinocytosis    Ras GTPases     117735017 (zgc:55558) GTP-binding proteins [BR:clum04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117735017 (zgc:55558) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin MeaB Motif Other DBs NCBI-GeneID:  117735017 NCBI-ProteinID:  XP_034395298 Ensembl:  ENSCLMG00005008265 LinkDB All DBs Position 8:complement(7049680..7053629) Genome browser AA seq 190 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL STRTVESRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKSK KNTQRRCAIL NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaactggtggtggtcggggcaggaggtgtggggaagagcgccctcacc atccagctcatccagaaccacttcgtggatgaatatgatccaaccatcgaggactcgtac agaaaacaggtggtgatcgatggagagacttgtctgctggacatcttggacacagccggt caggaggagtacagcgccatgagggaccagtacatgagaacgggagagggcttcctctgc gtgtttgccatcaacaacaccaagtcctttgaggacgtccacctgtacagagagcagatc aacagggtgaaggacagtgacagtgttccaatggtgctggtggggaataagagtgacctg agtacccgcacggtggagtcacggcaggcgcaggagctggctagaagctacggagtaccg tttgtcgagacctctgccaaaacccgacagggcgtggaggaagctttttattcgctagta cgggagattagaagatacaaggagaccaatcgcagcaacaagaagagcaagaagagcaag aagaacactcagagacgttgcgcaatactatag

DBGET integrated database retrieval system