Caldivirga maquilingensis: Cmaq_1169 Help Entry Cmaq_1169         CDS       T00611                                  Name (GenBank) hypothetical protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism cma  Caldivirga maquilingensis Pathway cma00290   Valine, leucine and isoleucine biosynthesis cma00650   Butanoate metabolism cma00660   C5-Branched dibasic acid metabolism cma00770   Pantothenate and CoA biosynthesis cma01100   Metabolic pathways cma01110   Biosynthesis of secondary metabolites cma01210   2-Oxocarboxylic acid metabolism cma01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:cma00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     Cmaq_1169    00660 C5-Branched dibasic acid metabolism     Cmaq_1169   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     Cmaq_1169   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     Cmaq_1169 Enzymes [BR:cma01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      Cmaq_1169 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  ABW01996 UniProt:  A8MDZ0 LinkDB All DBs Position complement(1227270..1227560) Genome browser AA seq 96 aa AA seqDB search MNNYKITITLLNNDGSVDPLVRALNVIRRGKVNVKSMVTSFNQNHVNVEVYVEGIEDEVN WVCNKLNKLYDVVNVSYTTSISIPKVQSLQVGERNG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaataactataagataaccataaccctattgaataatgatggaagcgtggatccactg gtcagggcgcttaacgtgattaggaggggtaaggtgaacgttaagtcaatggtaacctca tttaatcagaatcacgttaacgttgaagtgtatgttgagggtattgaggatgaggttaac tgggtttgcaataaattgaataaactgtacgatgtagttaacgtaagctatacaacaagt ataagtatacctaaagtgcagtccctacaggtaggtgagaggaatggctaa

DBGET integrated database retrieval system