Callorhinchus milii (elephant shark): 103176005 Help Entry 103176005         CDS       T03088                                  Name (RefSeq) tubulin beta-4 chain   KO K07375   tubulin beta Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk04145   Phagocytosis cmk04517   IgSF CAM signaling cmk04540   Gap junction cmk04814   Motor proteins cmk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103176005  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     103176005   09144 Cellular community - eukaryotes    04540 Gap junction     103176005   09142 Cell motility    04814 Motor proteins     103176005  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103176005  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cmk03036]     103176005   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cmk04812]     103176005    04147 Exosome [BR:cmk04147]     103176005 Chromosome and associated proteins [BR:cmk03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      103176005 Cytoskeleton proteins [BR:cmk04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     103176005 Exosome [BR:cmk04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103176005   Exosomal proteins of colorectal cancer cells    103176005   Exosomal proteins of bladder cancer cells    103176005 SSDB OrthologParalogGFIT Motif Pfam:  Tubulin Misat_Tub_SegII Motif Other DBs NCBI-GeneID:  103176005 NCBI-ProteinID:  XP_042196320 UniProt:  A0A4W3J1V3 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSELQLERISVYYNEASSLKYV PRAILVDLEPGTMDSVRSGPFGHLFRPDNFIFGM NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgagagagatcgtccacatccaagcgggtcagtgcggcaaccagatcggtgccaagttt tgggaggtgatcagcgacgaacatggaatcgaccccagcgggaattatgtgggtgactca gaactgcagttggagagaattagcgtctattacaatgaagcatcttctctcaagtacgtg cctcgagccatccttgtggacctggaaccaggcacaatggacagtgttcgttcaggaccc tttggacatctctttagaccagacaattttatttttggtatgtag

DBGET integrated database retrieval system