Caldicellulosiruptor morganii: OTK00_001617 Help Entry OTK00_001617      CDS       T08774                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cmor  Caldicellulosiruptor morganii Pathway cmor00020   Citrate cycle (TCA cycle) cmor00720   Other carbon fixation pathways cmor01100   Metabolic pathways cmor01110   Biosynthesis of secondary metabolites cmor01120   Microbial metabolism in diverse environments cmor01200   Carbon metabolism cmor01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cmor00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     OTK00_001617   09102 Energy metabolism    00720 Other carbon fixation pathways     OTK00_001617 Enzymes [BR:cmor01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      OTK00_001617 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_2 Fer4_6 Fer4_7 Fer4_9 Fer4_4 Fer4_21 Fer4_8 Fer4_13 Fer4_3 Fer4_16 Fer4_15 Fer4_17 Fer4_22 LdpA_Fe-S-bd Fer4_18 Motif Other DBs NCBI-ProteinID:  WAM33143 UniProt:  A0ABY7BK03 LinkDB All DBs Position complement(1622212..1622418) Genome browser AA seq 68 aa AA seqDB search MVKLKIEYDKCKSCGLCVEVCPKKILYIDRSRINKKGYNPVEVKDAEACIGCGSCYKVCP DIVFEVGE NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggtgaaacttaagatcgagtatgataagtgcaaaagctgtggactttgtgtggaggtt tgtcccaagaagatcctgtatattgataggtcaagaattaataaaaaaggttataaccct gttgaagtaaaagacgcagaggcatgcattggttgtggaagctgttacaaagtttgcccg gatattgtatttgaggtaggtgaatga

DBGET integrated database retrieval system