Cupriavidus necator N-1: CNE_1c02560 Help Entry CNE_1c02560       CDS       T01564                                  Symbol folB Name (GenBank) dihydroneopterin aldolase FolB   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cnc  Cupriavidus necator N-1 Pathway cnc00790   Folate biosynthesis cnc01100   Metabolic pathways cnc01240   Biosynthesis of cofactors Module cnc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:cnc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CNE_1c02560 (folB) Enzymes [BR:cnc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CNE_1c02560 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CNE_1c02560 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CNE_1c02560 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF3734 Motif Other DBs NCBI-ProteinID:  AEI75625 UniProt:  G0ETF4 LinkDB All DBs Position 1:254454..254855 Genome browser AA seq 133 aa AA seqDB search MTMLAALSHPSLQDCRRMFLRNYEVQINIGVHEFEKKGEQRVLINIDLFVPLAQSTPQAD KLDEVVDYDFMRNTVAERMAQGHVHLQETLCDDVARAMLKHPKVRAVRVSTEKPDVYPDC DSVGVEVFHIKQA NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgaccatgctcgccgccctttcccaccccagcctgcaagactgccgacgcatgttcctg cgcaactacgaagtgcagatcaatatcggcgtgcacgaattcgagaagaagggcgagcag cgggtgctgatcaatatcgacctgttcgtgccgctggcgcagagcaccccgcaggccgac aagctcgatgaagtggtcgactacgacttcatgcgcaacaccgtggccgagcgcatggcg cagggccacgtgcacttgcaggaaaccttgtgcgacgacgtcgcgcgcgcgatgctgaag catcccaaggtgcgcgcggtgcgcgtctcgaccgagaagcccgacgtctacccggactgc gattcggtcggggtcgaggtcttccatatcaagcaggcctga

DBGET integrated database retrieval system