Candida orthopsilosis: CORT_0C04170 Help Entry CORT_0C04170      CDS       T02488                                  Name (RefSeq) Rpo26 RNA polymerase subunit   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism cot  Candida orthopsilosis Pathway cot03020   RNA polymerase cot03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cot00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CORT_0C04170   09124 Replication and repair    03420 Nucleotide excision repair     CORT_0C04170  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cot03021]     CORT_0C04170    03400 DNA repair and recombination proteins [BR:cot03400]     CORT_0C04170 Transcription machinery [BR:cot03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CORT_0C04170   RNA polymerase III system    RNA polymerase III      CORT_0C04170   RNA polymerase I system    RNA polymerase I      CORT_0C04170 DNA repair and recombination proteins [BR:cot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CORT_0C04170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  14539311 NCBI-ProteinID:  XP_003868694 UniProt:  H8X402 LinkDB All DBs Position 3:complement(941898..942374) Genome browser AA seq 158 aa AA seqDB search MSDYEDNAFREVADAYEDFDPPDHFSDNEFDDPNGGDAQLTTDDGRQIINGGIGPDDAAT AASAQQQRKKTTKELAIPKDQRTTTPYMTKYERARILGTRALQISLNAPVLVDIEGETDP LQIAMKELSQRKIPLVIRRYLPDGSYEDWGCDELIVDQ NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgtccgattacgaagacaatgcatttcgtgaggtagcagacgcatatgaagactttgat ccaccagatcacttttcagataatgaatttgatgatccaaatggaggtgatgctcaacta accacagatgatgggagacaaatcatcaatggaggtattggacctgatgatgcagctact gctgcatcagctcaacaacaaaggaaaaagaccacaaaagaactagctatacctaaagat caaaggacaactactccatacatgactaaatatgagcgtgcgagaattttgggtacgaga gcattacaaatttcattaaatgctcctgtccttgttgacatagaaggtgaaactgatcct ttacaaattgccatgaaagagttgtctcaaagaaagatccccttggtgattagaagatac ttgcctgatggatcatatgaagattggggatgtgatgaattgattgttgaccagtag

DBGET integrated database retrieval system