Candida orthopsilosis: CORT_0C05900 Help Entry CORT_0C05900      CDS       T02488                                  Name (RefSeq) Rpb9 protein   KO K03017   DNA-directed RNA polymerase II subunit RPB9 Organism cot  Candida orthopsilosis Pathway cot03020   RNA polymerase cot03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cot00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CORT_0C05900   09124 Replication and repair    03420 Nucleotide excision repair     CORT_0C05900  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cot03021]     CORT_0C05900    03400 DNA repair and recombination proteins [BR:cot03400]     CORT_0C05900 Transcription machinery [BR:cot03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      CORT_0C05900 DNA repair and recombination proteins [BR:cot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CORT_0C05900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TFIIS_C RNA_POL_M_15KD Nudix_N_2 DZR RUBY_RBDX zinc_ribbon_13 Motif Other DBs NCBI-GeneID:  14539737 NCBI-ProteinID:  XP_003868867 UniProt:  H8X3A3 LinkDB All DBs Position 3:complement(1339735..1340073) Genome browser AA seq 112 aa AA seqDB search MASFRFCAECNNMLYPKEDKEDQRLLYACRNCGYTELAENPKVYRHELMTNIGATAGVVE DIGNDPTLPRSDKECTRCGNRDCVFFQSQQRRKDTSMILFFVCLECKNVFQA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggcatctttcagattctgcgcagagtgcaataacatgttgtacccaaaggaggacaaa gaggatcaacgtctactctatgcatgtcgaaattgtggatataccgaattagcagaaaac cccaaagtgtatcgtcacgaattaatgactaacatcggtgccactgctggtgttgttgaa gatatcggcaatgatccaactttaccccgaagtgataaagaatgtacccgttgtgggaac cgcgattgtgtgtttttccaatcacaacaaaggcgtaaagatacaagtatgattttgttc tttgtatgtttagagtgcaagaacgtttttcaagcatag

DBGET integrated database retrieval system