Coprothermobacter proteolyticus: COPRO5265_1080 Help Entry COPRO5265_1080    CDS       T00773                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cpo  Coprothermobacter proteolyticus Pathway cpo00020   Citrate cycle (TCA cycle) cpo01100   Metabolic pathways cpo01110   Biosynthesis of secondary metabolites cpo01120   Microbial metabolism in diverse environments cpo01200   Carbon metabolism cpo01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cpo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     COPRO5265_1080 Enzymes [BR:cpo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      COPRO5265_1080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_21 Fer4_9 Fer4_2 Fer4_10 Fer4_16 Fer4_4 Fer4_15 Fer4_13 Fer4_17 Fer4_8 Fer4_3 Fer4_22 Fer4_18 DUF6438 Motif Other DBs NCBI-ProteinID:  ACI17271 UniProt:  B5Y9E4 LinkDB All DBs Position complement(957007..957219) Genome browser AA seq 70 aa AA seqDB search MANFSVFVDTRLCKSCGLCVMVCPKKVFELRAPDGKSVPVREEDCIGCTQCFNICPDFAI TVFKKEGVQA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt ttggcgaatttttctgtgtttgtggataccaggttgtgtaaatcctgtgggctgtgtgtc atggtgtgcccaaaaaaggtattcgagctaagagctcccgatgggaagagtgtccccgtc agagaagaggattgcatcgggtgcacccagtgttttaacatttgtcctgattttgcaata acggtcttcaagaaagaaggtgttcaagcttga

DBGET integrated database retrieval system