Cloacibacillus porcorum: BED41_08365 Help Entry BED41_08365       CDS       T04453                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cpor  Cloacibacillus porcorum Pathway cpor00020   Citrate cycle (TCA cycle) cpor01100   Metabolic pathways cpor01110   Biosynthesis of secondary metabolites cpor01120   Microbial metabolism in diverse environments cpor01200   Carbon metabolism cpor01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cpor00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BED41_08365 Enzymes [BR:cpor01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BED41_08365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_6 Fer4_9 Fer4_10 Fer4_2 Fer4_4 Fer4_16 Fer4_3 Fer4_8 Fer4_13 Fer4_22 Fer4_15 Fer4_17 Motif Other DBs NCBI-ProteinID:  ANZ45089 UniProt:  A0A1B2I540 LinkDB All DBs Position complement(1878857..1879057) Genome browser AA seq 66 aa AA seqDB search MAKKFNIDVVEKWCKGCGLCIAICPKKVLELNDQVKSVAVRPEDCIGCRQCENICPDLAI TVKECE NT seq 201 nt NT seq  +upstreamnt  +downstreamnt ttggcgaagaagttcaacatcgacgttgttgagaagtggtgtaaaggatgtggcctctgt atcgctatatgccccaagaaggttctggaacttaacgatcaggttaagagcgtagcggtt cgtccggaggactgcattggctgccgccagtgcgagaatatctgcccggacctggcaatc actgttaaggagtgtgaataa

DBGET integrated database retrieval system