Crassaminicella profunda: K7H06_08180 Help Entry K7H06_08180       CDS       T07525                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cprf  Crassaminicella profunda Pathway cprf00020   Citrate cycle (TCA cycle) cprf01100   Metabolic pathways cprf01110   Biosynthesis of secondary metabolites cprf01120   Microbial metabolism in diverse environments cprf01200   Carbon metabolism cprf01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cprf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K7H06_08180 Enzymes [BR:cprf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K7H06_08180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_9 Fer4_21 Fer4_10 Fer4_6 Fer4_16 Fer4_4 Fer4_8 Fer4_3 Fer4_17 Fer4_13 Fer4_15 Fer4_22 ETF_QO Motif Other DBs NCBI-ProteinID:  QZY56883 LinkDB All DBs Position 1746651..1746863 Genome browser AA seq 70 aa AA seqDB search MANQNEKKLIVKKSWCKGCGICVEFCPKNVLALKHEKVEIVDMENCIKCGLCELRCPDYA IYLGGIEDEK NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcaaaccagaatgaaaagaaactaatcgtaaaaaaaagctggtgtaagggctgtgga atttgtgtagaattctgccccaaaaacgtgcttgctttaaaacatgaaaaagttgagatt gtagatatggaaaattgtattaaatgtggattatgtgaattacgctgtcctgattatgca atttatctaggaggtattgaagatgaaaaataa

DBGET integrated database retrieval system