Cellulosimicrobium protaetiae: FIC82_006265 Help Entry FIC82_006265      CDS       T08736                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism cprt  Cellulosimicrobium protaetiae Pathway cprt00261   Monobactam biosynthesis cprt01100   Metabolic pathways cprt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cprt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FIC82_006265  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cprt01008]     FIC82_006265 Polyketide biosynthesis proteins [BR:cprt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FIC82_006265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QJW35860 UniProt:  A0A6M5UC78 LinkDB All DBs Position 1470377..1470604 Genome browser AA seq 75 aa AA seqDB search MNPFDDTDGTFLVLVNDEQQHSLWPEFAAVPAGWTVALGASSRADALAYVDAHWTDLRPA SLRRVLDASAPAPTT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaaccccttcgacgacaccgacggcaccttcctcgtgctcgtcaacgacgagcagcag cactcgctctggcccgagttcgccgccgtccccgccggctggaccgtcgcgctcggtgcg tcgtcgcgcgccgacgcgctcgcgtacgtggacgcgcactggaccgacctgcgccccgcg agcctgcgccgggtgctggacgcgtccgcaccggcccccacgacgtga

DBGET integrated database retrieval system