Coniophora puteana: CONPUDRAFT_81756 Help Entry CONPUDRAFT_81756  CDS       T03134                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism cput  Coniophora puteana Pathway cput03020   RNA polymerase cput03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cput00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CONPUDRAFT_81756   09124 Replication and repair    03420 Nucleotide excision repair     CONPUDRAFT_81756  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cput03021]     CONPUDRAFT_81756    03400 DNA repair and recombination proteins [BR:cput03400]     CONPUDRAFT_81756 Transcription machinery [BR:cput03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CONPUDRAFT_81756   RNA polymerase III system    RNA polymerase III      CONPUDRAFT_81756   RNA polymerase I system    RNA polymerase I      CONPUDRAFT_81756 DNA repair and recombination proteins [BR:cput03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CONPUDRAFT_81756 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD DUF5816 zinc_ribbon_10 MCM_OB zf-C3HC TF_Zn_Ribbon DZR_2 HypA zinc-ribbon_6 Zn-ribbon_8 OrfB_Zn_ribbon LysW-like_globular DZR zf-ribbon_3 HVO_2753_ZBP DUF6083 DUF951 Motif Other DBs NCBI-GeneID:  19210305 NCBI-ProteinID:  XP_007767644 JGI:  Conpu1_81756 UniProt:  A0A5M3MT60 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MNQGGHQGGGAFGQAPRQEAMEYICADCGAKNEIKSREPIRCRECGHRIMYKKRTTRMVQ FEAR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaaccagggaggacatcagggaggaggtgcattcggtcaagctccccgtcaggaggca atggaatatatctgcgctgactgtggagcaaaaaacgaaatcaaatcgcgagaaccgatc cggtgccgcgaatgtggccaccgtatcatgtacaaaaagcgcacaacgcgcatggtgcaa tttgaagcacgataa

DBGET integrated database retrieval system