Cryptosporidium parvum: cgd7_3240 Help Entry cgd7_3240         CDS       T00168                                  Name (RefSeq) transcription activator   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism cpv  Cryptosporidium parvum Pathway cpv03020   RNA polymerase cpv03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cpv00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     cgd7_3240   09124 Replication and repair    03420 Nucleotide excision repair     cgd7_3240  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cpv03021]     cgd7_3240    03400 DNA repair and recombination proteins [BR:cpv03400]     cgd7_3240 Transcription machinery [BR:cpv03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      cgd7_3240   RNA polymerase III system    RNA polymerase III      cgd7_3240   RNA polymerase I system    RNA polymerase I      cgd7_3240 DNA repair and recombination proteins [BR:cpv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       cgd7_3240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_RNApol_7kD Fin LysW-like_globular Zn-ribbon_8 HypA DUF1451 Motif Other DBs NCBI-GeneID:  3371836 NCBI-ProteinID:  XP_001388394 ApiDB_CryptoDB:  cgd7_3240 UniProt:  A3FPP8 LinkDB All DBs Position 7:complement(749260..749455) Genome browser AA seq 49 aa AA seqDB search MVEPVTYICGECGADVSLLSHGAAVRCRTCGCRILYKKRTRKMIQYEAR NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggttgaaccagttacatatatttgtggtgaatgcggtgctgatgttagtttgctatct cacggcgcagcagttagatgccgaacttgcggatgcaggattttatacaaaaagaggacg agaaagatgattcaatatgaagccaggtaa

DBGET integrated database retrieval system