Coccidioides posadasii: CPC735_048480 Help Entry CPC735_048480     CDS       T01332                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism cpw  Coccidioides posadasii Pathway cpw03020   RNA polymerase cpw03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cpw00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CPC735_048480   09124 Replication and repair    03420 Nucleotide excision repair     CPC735_048480  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cpw03021]     CPC735_048480    03400 DNA repair and recombination proteins [BR:cpw03400]     CPC735_048480 Transcription machinery [BR:cpw03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CPC735_048480   RNA polymerase III system    RNA polymerase III      CPC735_048480   RNA polymerase I system    RNA polymerase I      CPC735_048480 DNA repair and recombination proteins [BR:cpw03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CPC735_048480 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD FtrD-like DUF5816 HypA DZR_2 zinc_ribbon_13 DZR Zn-ribbon_8 Motif Other DBs NCBI-GeneID:  9691093 NCBI-ProteinID:  XP_003065623 UniProt:  C5PG25 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MSREAYQVPSFDNQQAQFSAGAGSAPTNANDELLSVIYVCGDCSARVQMKRGDQIRCKEC GHRVLYKERTKRSVTRDSLLLGVVLSGVLF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtctcgcgaagcctaccaagtcccttccttcgacaaccagcaggcccagttttccgct ggtgcgggctctgcgcccaccaatgcgaacgacgagctcctctccgtcatctatgtctgc ggcgactgcagcgctcgtgtgcaaatgaagcgtggagatcagattcggtgcaaagagtgt gggcaccgcgtgttatataaggagagaacaaagaggtcggttactcgagactccttgctt ttaggcgtggtgttgtcgggggttcttttttaa

DBGET integrated database retrieval system