Corynebacterium resistens: CRES_0185 Help Entry CRES_0185         CDS       T01538                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism crd  Corynebacterium resistens Pathway crd00790   Folate biosynthesis crd01100   Metabolic pathways crd01240   Biosynthesis of cofactors Module crd_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:crd00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CRES_0185 (folB) Enzymes [BR:crd01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CRES_0185 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CRES_0185 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CRES_0185 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF488 DUF244 Motif Other DBs NCBI-ProteinID:  AEI08548 UniProt:  F8E1Z4 LinkDB All DBs Position 224924..225310 Genome browser AA seq 128 aa AA seqDB search MADRIELIGLEAYGYHGVFDHEKAQGQKFLVDVVVWTDFRQAAGTDDLADTISYVDLADI AVEEVQSAGAKGAGHDLIETLASRIADRINGIGGVHAVEVTVHKPQAPIEYPFADVRVVA RRNSKNRG NT seq 387 nt NT seq  +upstreamnt  +downstreamnt gtggctgatcgcattgaactgatcgggctggaggcttatgggtatcacggcgttttcgat cacgagaaagcccaagggcaaaagtttttagtcgatgtggtggtgtggacggatttccgc caagctgctggaaccgacgacttggcggacacgatttcttatgttgaccttgccgatatc gcggttgaggaagtccagtccgccggtgctaagggagcgggccacgatctgatcgagact ttggcatcccgcatcgctgatcgaatcaatggcatcggtggggttcacgccgtggaagtc accgttcacaaaccgcaagcgcccattgaatacccttttgcggacgtgcgcgtagtagcc cgtcgcaacagcaagaaccgtggctag

DBGET integrated database retrieval system