Chlorocebus sabaeus (green monkey): 103238957 Help Entry 103238957         CDS       T04361                                  Symbol IGF1 Name (RefSeq) insulin like growth factor 1   KO K05459   insulin-like growth factor 1 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab01521   EGFR tyrosine kinase inhibitor resistance csab01522   Endocrine resistance csab04010   MAPK signaling pathway csab04014   Ras signaling pathway csab04015   Rap1 signaling pathway csab04066   HIF-1 signaling pathway csab04068   FoxO signaling pathway csab04114   Oocyte meiosis csab04115   p53 signaling pathway csab04150   mTOR signaling pathway csab04151   PI3K-Akt signaling pathway csab04152   AMPK signaling pathway csab04211   Longevity regulating pathway csab04213   Longevity regulating pathway - multiple species csab04510   Focal adhesion csab04550   Signaling pathways regulating pluripotency of stem cells csab04730   Long-term depression csab04750   Inflammatory mediator regulation of TRP channels csab04913   Ovarian steroidogenesis csab04914   Progesterone-mediated oocyte maturation csab04935   Growth hormone synthesis, secretion and action csab04960   Aldosterone-regulated sodium reabsorption csab05200   Pathways in cancer csab05202   Transcriptional misregulation in cancer csab05205   Proteoglycans in cancer csab05214   Glioma csab05215   Prostate cancer csab05218   Melanoma csab05224   Breast cancer csab05410   Hypertrophic cardiomyopathy csab05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103238957 (IGF1)    04014 Ras signaling pathway     103238957 (IGF1)    04015 Rap1 signaling pathway     103238957 (IGF1)    04066 HIF-1 signaling pathway     103238957 (IGF1)    04068 FoxO signaling pathway     103238957 (IGF1)    04151 PI3K-Akt signaling pathway     103238957 (IGF1)    04152 AMPK signaling pathway     103238957 (IGF1)    04150 mTOR signaling pathway     103238957 (IGF1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103238957 (IGF1)    04115 p53 signaling pathway     103238957 (IGF1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103238957 (IGF1)    04550 Signaling pathways regulating pluripotency of stem cells     103238957 (IGF1)  09150 Organismal Systems   09152 Endocrine system    04913 Ovarian steroidogenesis     103238957 (IGF1)    04914 Progesterone-mediated oocyte maturation     103238957 (IGF1)    04935 Growth hormone synthesis, secretion and action     103238957 (IGF1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     103238957 (IGF1)   09156 Nervous system    04730 Long-term depression     103238957 (IGF1)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103238957 (IGF1)   09149 Aging    04211 Longevity regulating pathway     103238957 (IGF1)    04213 Longevity regulating pathway - multiple species     103238957 (IGF1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103238957 (IGF1)    05202 Transcriptional misregulation in cancer     103238957 (IGF1)    05205 Proteoglycans in cancer     103238957 (IGF1)   09162 Cancer: specific types    05214 Glioma     103238957 (IGF1)    05218 Melanoma     103238957 (IGF1)    05215 Prostate cancer     103238957 (IGF1)    05224 Breast cancer     103238957 (IGF1)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     103238957 (IGF1)    05414 Dilated cardiomyopathy     103238957 (IGF1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103238957 (IGF1)    01522 Endocrine resistance     103238957 (IGF1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103238957 (IGF1) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Growth factors (RTK binding)    103238957 (IGF1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin DUF2865 Motif Other DBs NCBI-GeneID:  103238957 NCBI-ProteinID:  XP_008002630 Ensembl:  ENSCSAG00000003294 LinkDB All DBs Position 11:complement(97624498..97708730) Genome browser AA seq 208 aa AA seqDB search MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS VRAQRHTDMPKTQKYQPPSTNKNTKSQRRRKGGPKTHPGGEQKEGTEASLQIRGKKKEQR REIGSRNAECRGKKGKWRTGGLSRQRQG NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcactgtgcctgctc accttcaccagctccgccacggctggaccggagacgctctgcggggctgagctggtggat gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc tccagcagtcggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgt gatctgagaaggctggagatgtattgcgcacccctcaagcctgccaagtcagcccgctct gtccgtgcccagcgccataccgacatgcccaagacccagaagtatcagcccccatctacc aacaagaacacgaagtctcagaggagaaggaaaggtgggccaaagacacatccaggaggg gaacagaaggaggggacagaagcaagtctgcagatcagaggaaagaagaaagagcagagg agggagattggaagtagaaatgctgaatgcagaggcaaaaaaggaaaatggaggacagga ggactaagcagacagaggcaaggatga

DBGET integrated database retrieval system