Colius striatus (speckled mousebird): 104561775 Help Entry 104561775         CDS       T08355                                  Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism csti  Colius striatus (speckled mousebird) Pathway csti00860   Porphyrin metabolism csti04216   Ferroptosis csti04217   Necroptosis Brite KEGG Orthology (KO) [BR:csti00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     104561775  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     104561775    04217 Necroptosis     104561775  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csti04147]     104561775 Enzymes [BR:csti01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      104561775 Exosome [BR:csti04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104561775   Exosomal proteins of bladder cancer cells    104561775 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  104561775 NCBI-ProteinID:  XP_010205888 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search CEFLLVSFQSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKP DRDDWENGLTAMECALHLEKNVNQSLLELHKLATEKNDPH NT seq 302 nt NT seq  +upstreamnt  +downstreamnt catgtgaattcttgttggtttcttttcagtcctactattttgaccgggatgatgtggccc tgaagaactttgccaagtactttctgcatcagtcccacgaggagcgtgagcacgctgaga agctgatgaagctgcagaatcagcgcggcgggcgcatcttcttgcaggacatcaagaaac cagatcgtgatgactgggagaatggtctgactgcaatggagtgtgccctgcacctggaga agaatgtgaaccagtcactgttagagctgcacaaactggcaactgaaaagaatgatccac ac

DBGET integrated database retrieval system