Colius striatus (speckled mousebird): 104563677 Help Entry 104563677         CDS       T08355                                  Name (RefSeq) cyclin-dependent kinase 2   KO K02206   cyclin-dependent kinase 2 [EC:2.7.11.22] Organism csti  Colius striatus (speckled mousebird) Pathway csti04068   FoxO signaling pathway csti04110   Cell cycle csti04114   Oocyte meiosis csti04115   p53 signaling pathway csti04218   Cellular senescence csti04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:csti00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     104563677  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     104563677    04114 Oocyte meiosis     104563677    04115 p53 signaling pathway     104563677    04218 Cellular senescence     104563677  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     104563677  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:csti01001]     104563677   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:csti03032]     104563677    03036 Chromosome and associated proteins [BR:csti03036]     104563677 Enzymes [BR:csti01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      104563677 Protein kinases [BR:csti01001]  Serine/threonine kinases: CMGC group   CDK family    104563677 DNA replication proteins [BR:csti03032]  Eukaryotic type   DNA Replication Initiation Factors    CDK (cyclin dependent kinase)     104563677 Chromosome and associated proteins [BR:csti03036]  Eukaryotic type   Centrosome formation proteins    Kinases and associated factors     104563677 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Haspin_kinase APH Motif Other DBs NCBI-GeneID:  104563677 NCBI-ProteinID:  XP_010208509 LinkDB All DBs Position Unknown AA seq 168 aa AA seqDB search LLDVIHTENKLYLVFEFLHQDLKKFMDSSTISGIALPLIKSYLFQLLQGLAFCHAHRVLH RDLKPQNLLINADGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVD IWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEAAWPGVTAM NT seq 504 nt NT seq  +upstreamnt  +downstreamnt ctgctggatgtcatccacacggagaacaagctctacttggtgttcgagttcctacatcaa gacctgaagaagttcatggactcatccaccatcagtggcatcgctctgcccctcatcaag agctacctgttccagctgctgcagggcctggccttctgccatgcgcaccgcgtcctgcac cgcgacctcaagccccagaacctgctcatcaatgctgatggtgccatcaagctggccgac ttcggcctggcccgcgcctttggagtgcctgtccgcacctacacacatgaggtggtgacc ctctggtatcgagcccccgagatcctcctgggctgcaagtactattcgacagccgttgac atctggagcttgggctgcatctttgcggagatgatcacccggcgcgctctgtttcctggg gactcggagatcgaccagctcttccgcatcttccgtacgctgggcacgccagacgaggcg gcctggcctggtgtcactgccatg

DBGET integrated database retrieval system