Chlamydia suis: Chls_967 Help Entry Chls_967          CDS       T07130                                  Symbol folX Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism csui  Chlamydia suis Pathway csui00790   Folate biosynthesis csui01100   Metabolic pathways csui01240   Biosynthesis of cofactors Module csui_M00840   Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF Brite KEGG Orthology (KO) [BR:csui00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Chls_967 (folX) Enzymes [BR:csui01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Chls_967 (folX)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Chls_967 (folX)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Chls_967 (folX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QHP83842 UniProt:  A0A7H5P706 LinkDB All DBs Position complement(1068122..1068490) Genome browser AA seq 122 aa AA seqDB search MYRLDITDFRVWVSMGVTEQERHHAQPILVSVSLVFKEEPEACSSDEISDGVCYAALVSL IEKTLTSNPCALMERLAKVLLEKLEETLAGQVSRIDLRVSKERPPIPDLLGPVSFSIGRE VL NT seq 369 nt NT seq  +upstreamnt  +downstreamnt ttgtatcggttagacataactgattttcgtgtgtgggtatcgatgggtgttacagaacag gagcggcaccatgcgcagccgattcttgtttccgtgtctcttgtttttaaagaggaaccc gaggcatgttcttcggatgaaatttctgatggcgtttgttacgcggcgcttgtctctctt attgaaaagacgttaacaagtaatccctgtgctttaatggaacgtttagctaaggttttg ctggaaaaattagaagagactttagcgggacaggttagtaggattgatttacgagtgagt aaagagcgtccaccgatcccagatttgttaggccctgttagttttagcataggtagagag gttctgtga

DBGET integrated database retrieval system