Chroococcidiopsis thermalis: Chro_3733 Help Entry Chro_3733         CDS       T02360                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism cthe  Chroococcidiopsis thermalis Pathway cthe00261   Monobactam biosynthesis cthe01100   Metabolic pathways cthe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cthe00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Chro_3733  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cthe01008]     Chro_3733 Polyketide biosynthesis proteins [BR:cthe01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Chro_3733 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFY89169 UniProt:  K9U4J8 LinkDB All DBs Position 4237075..4237299 Genome browser AA seq 74 aa AA seqDB search MNNADTENQTIYKVVVNHEEQYSIWPADRENALGWRDAGKSGLKSECLEYIKEVWTDMRP LSLRKKMEELSSQN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaataacgccgatacagaaaaccaaactatttataaagttgtggttaatcatgaagaa cagtattctatttggcctgctgatagagaaaatgctcttggttggagagatgcaggtaaa agtgggctgaaatcagaatgtctagaatacattaaagaagtatggactgatatgagacct ctaagtttgcgaaagaaaatggaggagctatctagccaaaattaa

DBGET integrated database retrieval system