Chlamydia trachomatis IU824: BN197_6231 Help Entry BN197_6231        CDS       T02493                                  Symbol folX Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ctri  Chlamydia trachomatis IU824 Pathway ctri00790   Folate biosynthesis ctri01100   Metabolic pathways ctri01240   Biosynthesis of cofactors Module ctri_M00840   Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF Brite KEGG Orthology (KO) [BR:ctri00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BN197_6231 (folX) Enzymes [BR:ctri01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BN197_6231 (folX)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BN197_6231 (folX)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BN197_6231 (folX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  CCP28412 LinkDB All DBs Position complement(694694..695068) Genome browser AA seq 124 aa AA seqDB search MLLYRLDIADFRVWVSIGVSEQERHYPQPVLVSLSLFFKEEPKACSTDKVSDSVCYAELV SLIEEVATNNPCALIERLAKVLLEKIEKALAGQVSRIDLRVSKERPPIPDLLSPVSFSIS REVP NT seq 375 nt NT seq  +upstreamnt  +downstreamnt gtgttgttgtatcgtttagatatagcggattttcgcgtttgggtatctataggagtctca gaacaagaacggcattatccgcagcccgttcttgtttctttatctcttttttttaaagaa gagccaaaggcttgttccacggacaaagtctctgatagcgtgtgttatgcagagcttgtt tctcttattgaagaagttgcaacgaataatccttgtgctttaattgaacgtttagctaag gttttgctggaaaaaatagaaaaggctttggctggacaagtttctaggattgacttgcga gtaagtaaagagcgtcctccgatcccagatctactcagtcctgtaagtttcagcataagt agagaggtgccatga

DBGET integrated database retrieval system