Chlamydia trachomatis A2497: CTR_6181 Help Entry CTR_6181          CDS       T01707                                  Symbol folX Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cty  Chlamydia trachomatis A2497 Pathway cty00790   Folate biosynthesis cty01100   Metabolic pathways cty01240   Biosynthesis of cofactors Module cty_M00840   Tetrahydrofolate biosynthesis, mediated by ribA and trpF, GTP => THF Brite KEGG Orthology (KO) [BR:cty00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CTR_6181 (folX) Enzymes [BR:cty01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CTR_6181 (folX)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CTR_6181 (folX)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CTR_6181 (folX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  CAX09285 UniProt:  G4NMQ9 LinkDB All DBs Position complement(696221..696595) Genome browser AA seq 124 aa AA seqDB search MLLYRLDIADFRVWVSIGVSEQERHYPQPVLVSLSLFFKEEPKACSTDKVSDSVCYAELV SLIEEVATNNPCALIERLAKVLLEKIEKALAGQVSRIDLRVSKERPPIPDLLSPVSFSIS REVP NT seq 375 nt NT seq  +upstreamnt  +downstreamnt gtgttgttgtatcgtttagatatagcggattttcgcgtttgggtatctataggagtctca gaacaagaacggcattatccgcagcccgttcttgtttctttatctcttttttttaaagaa gagccaaaggcttgttccacggacaaagtctctgatagcgtgtgttatgcagagcttgtt tctcttattgaagaagttgcaacgaataatccttgtgctttaattgaacgtttagctaag gttttgctggaaaaaatagaaaaggctttggctggacaagtttctaggattgacttgcga gtaagtaaagagcgtcctccgatcccagatctactcagtcctgtaagtttcagcataagt agagaggtgccatga

DBGET integrated database retrieval system