Crocosphaera watsonii: CwatDRAFT_6365 Help Entry CwatDRAFT_6365    CDS       T05097                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism cwa  Crocosphaera watsonii Pathway cwa00261   Monobactam biosynthesis cwa01100   Metabolic pathways cwa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cwa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CwatDRAFT_6365  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cwa01008]     CwatDRAFT_6365 Polyketide biosynthesis proteins [BR:cwa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CwatDRAFT_6365 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  EAM53341 UniProt:  Q4C9E5 LinkDB All DBs Position 651900..652106 AA seq 68 aa AA seqDB search MKQDEREDTTNYRVVVNHEEQYSIWPDYRDIPAGWRDTGKSGQKEDCLEYIKEVWTDMRP LSLRKKME NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaacaagatgagcgagaagatacaacaaactatcgggttgttgttaatcatgaggaa cagtattctatctggccagactatcgagatattccggccggttggagagatacaggaaaa agtggacaaaaagaagactgtcttgagtatataaaagaagtctggacagatatgcgtccc ttaagtttgcgaaaaaagatggaataa

DBGET integrated database retrieval system