Desulfosporosinus acidiphilus: Desaci_3321 Help Entry Desaci_3321       CDS       T02148                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dai  Desulfosporosinus acidiphilus Pathway dai00020   Citrate cycle (TCA cycle) dai00720   Carbon fixation pathways in prokaryotes dai01100   Metabolic pathways dai01110   Biosynthesis of secondary metabolites dai01120   Microbial metabolism in diverse environments dai01200   Carbon metabolism dai01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dai00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Desaci_3321   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     Desaci_3321 Enzymes [BR:dai01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Desaci_3321 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_10 Fer4_21 Fer4_6 Fer4_15 Fer4_9 Fer4_16 Fer4_8 Fer4_4 Fer4_13 Fer4_17 Fer4_22 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  AFM42217 UniProt:  I4D8U3 LinkDB All DBs Position complement(3459017..3459259) Genome browser AA seq 80 aa AA seqDB search MLKVEFEEDRCKGCELCADACPKHIIIMAEHLNSMGFHPAVVLEQEKCISCGFCARMCPD VVITVRKEEKANGQSALEGK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcttaaagttgagtttgaggaagatcgttgtaagggttgtgagctttgtgcagatgct tgtccgaaacatatcattattatggccgaacatctgaattcaatgggctttcatcctgct gttgtactggaacaggaaaaatgtatttcttgcgggttctgtgccagaatgtgcccggac gttgttattacggtgcgaaaggaggagaaggcaaatgggcaaagtgctcttgaagggaaa tga

DBGET integrated database retrieval system