Desulfosarcina alkanivorans: DSCA_38990 Help Entry DSCA_38990        CDS       T06544                                  Name (GenBank) hypothetical protein   KO K01779   aspartate racemase [EC:5.1.1.13] Organism dalk  Desulfosarcina alkanivorans Pathway dalk00250   Alanine, aspartate and glutamate metabolism dalk00470   D-Amino acid metabolism dalk01054   Nonribosomal peptide structures dalk01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:dalk00001]  09100 Metabolism   09105 Amino acid metabolism    00250 Alanine, aspartate and glutamate metabolism     DSCA_38990   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     DSCA_38990   09109 Metabolism of terpenoids and polyketides    01054 Nonribosomal peptide structures     DSCA_38990  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:dalk01008]     DSCA_38990 Enzymes [BR:dalk01000]  5. Isomerases   5.1  Racemases and epimerases    5.1.1  Acting on amino acids and derivatives     5.1.1.13  aspartate racemase      DSCA_38990 Polyketide biosynthesis proteins [BR:dalk01008]  Nonribosomal peptide tailoring proteins   Others    DSCA_38990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asp_Glu_race Motif Other DBs NCBI-ProteinID:  BBO69969 UniProt:  A0A5K7YQ17 LinkDB All DBs Position complement(4391952..4392311) Genome browser AA seq 119 aa AA seqDB search MKTIGLLGTAFTMEQAFYKGRLADRYGLDVIVPDAADRRQVHDIIYNELCLGKVAPESKA AYLKIVDQLRQRGAEGVILGCTEIGLLIDGSDTAVPLFDTARIHAAKAVDRALSAKVDA NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaaaaccatcgggttgctgggcacggcctttaccatggagcaggcgttttacaagggg cggctggccgaccggtacgggctggatgtgatcgtgccggacgccgccgaccgtcggcag gtgcacgatatcatctacaatgaattgtgcctgggaaaggtcgcgccggagtcgaaagcg gcctacctgaagatcgtggaccaactcaggcaacggggtgccgagggcgtgatcctggga tgcactgaaatcggcctgttgatcgatgggtcggatacggcagtgcctttattcgatacg gccagaatccatgcggccaaagcggtggaccgggcgttgtccgcaaaggtcgacgcttaa

DBGET integrated database retrieval system