Pseudodesulfovibrio aespoeensis: Daes_2090 Help Entry Daes_2090         CDS       T01382                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism das  Pseudodesulfovibrio aespoeensis Pathway das00020   Citrate cycle (TCA cycle) das01100   Metabolic pathways das01110   Biosynthesis of secondary metabolites das01120   Microbial metabolism in diverse environments das01200   Carbon metabolism das01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:das00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Daes_2090 Enzymes [BR:das01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Daes_2090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_9 Fer4_10 Fer4_4 Fer4_16 Fer4_6 Fer4_8 Fer4_13 Fer4_17 Fer4_22 Fer4_3 Fer4_15 ETF_QO MepB-like DUF6757 Motif Other DBs NCBI-ProteinID:  ADU63097 UniProt:  E6VS52 LinkDB All DBs Position complement(2295441..2295713) Genome browser AA seq 90 aa AA seqDB search MANKKKGKSKITVYPDWCKGCGICVEFCPGRVLELSDQGKATVVREQDCIRCGFCELHCP DFAIVVQDKEFVEADQLKEPEKKKPVGKGA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggccaataagaaaaaagggaagagcaagatcaccgtgtaccccgactggtgcaagggg tgcggcatctgcgtcgaattctgtcccggcagggtgcttgagctgagcgaccagggcaag gccaccgtggtgcgcgagcaggactgcatccggtgcgggttctgcgagttgcactgtcct gattttgccatcgtggttcaggacaaggagttcgtggaagcggaccagctcaaggagccg gagaagaagaaaccagtcggcaagggggcgtag

DBGET integrated database retrieval system